3 products were found matching "GeneID 574243"!
No results were found for the filter!
C-X-C motif chemokine 10, active (CXCL10), Recombinant,...
Item number: 347995.5
Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3 (By similarity). {ECO:0000250}. Biological Activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10- 50ng/ml....
| Keywords: | IP-10, SCYB10, CXCL10, Gamma-IP10, C-X-C motif chemokine 10, Small-inducible cytokine B10, 10 kDa interferon gamma-induced... |
| MW: | 8,7 |
393.00€
*
Anti-CXCL10
Item number: G-PACO38206.50
CXCL10 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Macaca mulatta and for use in ELISA applications. CXCL10 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. [The UniProt Consortium]
| Keywords: | Anti-IP-10, Anti-SCYB10, Anti-CXCL10, Anti-Gamma-IP10, Anti-C-X-C motif chemokine 10, Anti-Small-inducible cytokine B10,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | Macaca mulatta |
363.00€
*
CXCL10, Recombinant, Macaca Mulatta, aa22-98, His-Tag...
Item number: 372922.100
Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. Source: Recombinant protein corresponding to aa22-98 from macaca mulatta CXCL10, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~12.7kD, AA Sequence: IPLSRTVRCTCISISNQPVNPRSLEKLEIIPPSQFCPHVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP,...
| Keywords: | IP-10, SCYB10, CXCL10, Gamma-IP10, C-X-C motif chemokine 10, Small-inducible cytokine B10, 10 kDa interferon gamma-induced... |
| MW: | 12,7 |
From 636.00€
*
